Protein Info for ABZR87_RS09205 in Ralstonia sp. UNC404CL21Col

Annotation: ankyrin repeat domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details PF12796: Ank_2" amino acids 73 to 132 (60 residues), 35.4 bits, see alignment E=3.3e-12 amino acids 140 to 236 (97 residues), 54.4 bits, see alignment E=3.9e-18 amino acids 175 to 254 (80 residues), 30.1 bits, see alignment E=1.5e-10 PF00023: Ank" amino acids 101 to 133 (33 residues), 24.3 bits, see alignment 7.2e-09 amino acids 167 to 199 (33 residues), 20.1 bits, see alignment 1.6e-07 amino acids 201 to 236 (36 residues), 19.6 bits, see alignment 2.3e-07 PF13637: Ank_4" amino acids 110 to 152 (43 residues), 23.1 bits, see alignment 1.8e-08 amino acids 142 to 184 (43 residues), 30.1 bits, see alignment 1.1e-10 PF13857: Ank_5" amino acids 155 to 208 (54 residues), 32.4 bits, see alignment E=2.4e-11

Best Hits

KEGG orthology group: K06867, (no description) (inferred from 96% identity to rpf:Rpic12D_0798)

Predicted SEED Role

"Ankyrin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>ABZR87_RS09205 ankyrin repeat domain-containing protein (Ralstonia sp. UNC404CL21Col)
MLIAPHPALNQLIGVMLGMALAVGDMANAWQEQHLPILHVAASAGAKVAPSTTRTPDARP
PRRSDPATRDRDLILAAQAGNTMAIQTLLAEGASLKARDADGRTALIAAVMAHMGAAARL
LIQAGADVNVQDNTQNSAFLLAASQGDAETVRLALSHGANLRATNGDGDTALIPAARRGY
VEVVNELVKAGVPPDATNNLGLTALIEAVALGDGSDKYEKTVQLLLDGGADPNLADRGGV
TPMRHARQRGFHGIGALLFKARGH