Protein Info for ABZR87_RS09145 in Ralstonia sp. UNC404CL21Col

Annotation: cyclopropane-fatty-acyl-phospholipid synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 PF02353: CMAS" amino acids 115 to 384 (270 residues), 346.9 bits, see alignment E=2.8e-107 PF08123: DOT1" amino acids 152 to 216 (65 residues), 25.1 bits, see alignment E=4.2e-09 PF13489: Methyltransf_23" amino acids 162 to 312 (151 residues), 45.9 bits, see alignment E=1.9e-15 PF13847: Methyltransf_31" amino acids 173 to 275 (103 residues), 27.6 bits, see alignment E=7.6e-10 PF13649: Methyltransf_25" amino acids 179 to 272 (94 residues), 58.5 bits, see alignment E=3.2e-19 PF08242: Methyltransf_12" amino acids 179 to 273 (95 residues), 44.7 bits, see alignment E=6.5e-15 PF08241: Methyltransf_11" amino acids 179 to 274 (96 residues), 47.2 bits, see alignment E=1e-15

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 98% identity to rpf:Rpic12D_0786)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>ABZR87_RS09145 cyclopropane-fatty-acyl-phospholipid synthase family protein (Ralstonia sp. UNC404CL21Col)
MFFQQAIDRKLEQWIHDIRESANLPVRLRLWNGDQYELGRFEQPRVTLTVREASALPLLL
SPTLNNLGEAYVQEKIDLDGKLADIINVGYSLASAAAVSSGNALARVVRHFAHTKEGDKE
SIQYHYDVSNDFYKLWLDQNMVYSCAYFENGDETLDEAQLKKIDHILTKIRLEPGQTLLD
IGCGWGALVLRAAQKYGARCLGVTLSQNQYDLATERVRAAGLQDQIEIRIQDYRDLTGQF
DRITSVGMFEHVGRKNLPGYFRRMHDLLADDGIAMNHGITSSDPAGGESSMGGGDFIDRY
VFPQGELPHISLALSAAQDGGLEALDVESLRRHYARTLEHWAERFETNGETIRAMVGEKK
YRIWRVYLAGCAHAFDADEISIFQTVLQKAGKSATSIPWSRRYIYA