Protein Info for ABZR87_RS09120 in Ralstonia sp. UNC404CL21Col

Annotation: arylformamidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03035: arylformamidase
  • amino acids 5 to 208 (204 residues), 339.4 bits, E=4.5e-106
• PF04199: Cyclase
  • amino acids 7 to 151 (145 residues), 63.8 bits, E=1.1e-21

Best Hits

Swiss-Prot: 94% identical to KYNB_RALPJ: Kynurenine formamidase (kynB) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K07130, (no description) (inferred from 96% identity to rpf:Rpic12D_0776)

Predicted SEED Role

"Kynurenine formamidase, bacterial (EC 3.5.1.9)" in subsystem Aromatic amino acid degradation or NAD and NADP cofactor biosynthesis global (EC 3.5.1.9)

MetaCyc Pathways

• L-tryptophan degradation I (via anthranilate) (3/3 steps found)
• NAD de novo biosynthesis II (from tryptophan) (7/9 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis II (3/5 steps found)
• L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (3/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis I (2/6 steps found)
• quinoxaline-2-carboxylate biosynthesis (4/10 steps found)
• 3-hydroxyquinaldate biosynthesis (2/8 steps found)
• L-tryptophan degradation III (eukaryotic) (6/15 steps found)
• L-tryptophan degradation IX (3/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (3/12 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (18/35 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (7/23 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (11/42 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.9

Protein Sequence (209 amino acids)

>ABZR87_RS09120 arylformamidase (Ralstonia sp. UNC404CL21Col)
MERTLWDISPALSPATPTWPGDTPFSHEIAWKLEGDCPVNVGRITLSPHTGAHADAPLHY
RADGAAIGQVPLGAYLGPCRVIHCMGVVRVEPEHVRDALTDVPPRVLLRTYAQMPQTAWD
DDFAAVAPETIALLAAHGVKLIGVDTASLDPQTSKTMDAHHAVGKHGLAILEGLVLDDVP
AGDYELIALPLKFATLDASPVRAVLRSLP