Protein Info for ABZR87_RS09060 in Ralstonia sp. UNC404CL21Col

Annotation: iron export ABC transporter permease subunit FetB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 224 to 247 (24 residues), see Phobius details PF03649: UPF0014" amino acids 11 to 251 (241 residues), 291 bits, see alignment E=3.2e-91 TIGR00245: TIGR00245 family protein" amino acids 14 to 257 (244 residues), 203.3 bits, see alignment E=2.2e-64

Best Hits

KEGG orthology group: K02069, putative ABC transport system permease protein (inferred from 95% identity to rpi:Rpic_0698)

Predicted SEED Role

"YbbM seven transmembrane helix protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>ABZR87_RS09060 iron export ABC transporter permease subunit FetB (Ralstonia sp. UNC404CL21Col)
MNGQDLSLSAWQVGIAAALILVNGALSIGLGLGLERRLAWAAVRTVVQLLAVGFVLEWVF
AHAHWAVVLGIVAVMTLIAGHATGSRGARGYAGLRLDGTLSVFGSTWLIGAIGLVIVLHA
RPWYEPQYAIPIMGMILGNTLTGVGLALERMTGELTATRDQVETVLALGGTRWEAARNAA
RTAVRAGMTPIINQMTVVGVVSLPGMMTGQVLGGQSPLEAVRYQIVIMFLLAASSGLGTV
AAVLLAYRRLFSPNHQLLSARITQRGGAK