Protein Info for ABZR87_RS09025 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 323 to 347 (25 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 389 to 409 (21 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 258 (242 residues), 148.5 bits, see alignment E=2.5e-47 amino acids 266 to 415 (150 residues), 56.5 bits, see alignment E=2.3e-19 PF00083: Sugar_tr" amino acids 46 to 407 (362 residues), 29.6 bits, see alignment E=3.4e-11

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_0757)

Predicted SEED Role

"2-ketogluconate transporter" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>ABZR87_RS09025 MFS transporter (Ralstonia sp. UNC404CL21Col)
MATQLAARRWWMIMPIVFITYSLAYLDRANYGFAAAAGINHDLGISQGLSSLIGALFFLG
YFFFQIPGAIYAERRSVKKLVFISLVLWGLCAALTGVVSDIPSLLAIRFVLGVVEAAVMP
AMLIYISNWFTKQERSRANTFLILGNPVTVLWMSVVSGYLVREFGWRHMFIAEGVPAIIW
AVCWWCLVQDKPAQAPWLSPQEKRDLEQALAAEQATIKPMRNYGEAFRSPAVIKLCAQYF
CWSIGVYGFVLWLPSIVKNGSSLGMVETGWLSALPYLAATIAMLAASWASDKVGSRRGFV
WPFLLVGAAAFAASFALGSTHFWMSYVLLVIAGAAMYAPYGPFFAIVPELLPKNVAGGAM
ALINSMGALGSFVGSYFVGYLNGATGSPLASYAFMSAALLAAVVLTLCVKPQPRDAYPLA
NPVPGK