Protein Info for ABZR87_RS09000 in Ralstonia sp. UNC404CL21Col

Annotation: 7-cyano-7-deazaguanine synthase QueC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF06508: QueC" amino acids 4 to 215 (212 residues), 255.5 bits, see alignment E=3.4e-80 TIGR00364: queuosine biosynthesis protein QueC" amino acids 5 to 208 (204 residues), 203.2 bits, see alignment E=1.6e-64 PF00733: Asn_synthase" amino acids 7 to 62 (56 residues), 34.5 bits, see alignment E=1.9e-12

Best Hits

Swiss-Prot: 99% identical to QUEC_RALPJ: 7-cyano-7-deazaguanine synthase (queC) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 99% identity to rpi:Rpic_0687)

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>ABZR87_RS09000 7-cyano-7-deazaguanine synthase QueC (Ralstonia sp. UNC404CL21Col)
MKKRAIVLLSGGLDSATVLAMANADGFETYALSMRYGQRHSSELEAAKKVAAALGAVRHE
IVDLDLRKFGGSALTDDTLDVPTDGAQSGIPITYVPARNTIMLSLALGWAEAVGARDLFF
GANAVDYSGYPDCRPEYVAAYETLANLATKAGVEGERIRVNAPIIDMTKAEIIQAGVRLG
VDYGLTVSCYKADDAGRACGVCDSCRIRKAGFEAAGVPDPTRYV