Protein Info for ABZR87_RS08995 in Ralstonia sp. UNC404CL21Col

Annotation: tol-pal system protein YbgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 65 to 127 (63 residues), 68 bits, see alignment E=2.4e-22 PF13512: TPR_18" amino acids 138 to 213 (76 residues), 30.1 bits, see alignment E=2e-10 TIGR02795: tol-pal system protein YbgF" amino acids 139 to 257 (119 residues), 125.7 bits, see alignment E=7.1e-41 PF09976: TPR_21" amino acids 143 to 242 (100 residues), 26.2 bits, see alignment E=2.5e-09 PF13525: YfiO" amino acids 143 to 261 (119 residues), 45.7 bits, see alignment E=2.9e-15 PF13432: TPR_16" amino acids 144 to 196 (53 residues), 27.6 bits, see alignment E=1.4e-09 PF13174: TPR_6" amino acids 215 to 246 (32 residues), 21.8 bits, see alignment 8.4e-08

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpf:Rpic12D_0730)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>ABZR87_RS08995 tol-pal system protein YbgF (Ralstonia sp. UNC404CL21Col)
MNTMMKQRAYGAMRQAILMATLVAGGALTMAGPAAAGVFDDDEARRAIIDMRDKFNNFQS
TAAQRIDQNSKNLIDAQNQIETLKSEVARLRGQNEVLQNSVDTLTKQQKDYYADLDARLK
KFEPQQATVDGREGMVQPNEKPEYDAALKAFQGGDFKGAGNQFSAFVKKYPQSPYLPLAQ
FWLGNALYAQRDYKGSSYVLENMARTNPQHPKAPDALLQVATNQGESGQKAAARKTLETV
ASQYPGTEQAKTAQSRLKTMR