Protein Info for ABZR87_RS08985 in Ralstonia sp. UNC404CL21Col

Annotation: Tol-Pal system beta propeller repeat protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 25 to 430 (406 residues), 509.3 bits, see alignment E=4.1e-157 PF04052: TolB_N" amino acids 33 to 131 (99 residues), 91.1 bits, see alignment E=1.2e-29 PF07676: PD40" amino acids 196 to 228 (33 residues), 31.2 bits, see alignment (E = 4e-11) amino acids 238 to 271 (34 residues), 33.9 bits, see alignment 5.9e-12 amino acids 280 to 316 (37 residues), 55.2 bits, see alignment 1.2e-18 amino acids 328 to 362 (35 residues), 34.5 bits, see alignment 3.9e-12 amino acids 377 to 402 (26 residues), 14 bits, see alignment (E = 9.9e-06) PF00930: DPPIV_N" amino acids 251 to 393 (143 residues), 23.8 bits, see alignment E=4.5e-09

Best Hits

Swiss-Prot: 86% identical to TOLB_RALSO: Tol-Pal system protein TolB (tolB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03641, TolB protein (inferred from 99% identity to rpf:Rpic12D_0728)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>ABZR87_RS08985 Tol-Pal system beta propeller repeat protein TolB (Ralstonia sp. UNC404CL21Col)
MNMMRTMWIPMFRRAAQALLLTAASVGVAHAQLNVEISGVGASQYPIAIANFQGEAQAPQ
NLSAIVRADLVRSGRFSNVDVAGAVVPESPAPDLGAWKSKGAAAFVGGTVTRNGDRYEIR
FRLYDTAKGESLGGLSLTRGPGQLRLAAHEIADYIYQKLIGERGVFATRLSYVSKVGRRF
QLQVSDSDGANPQIALTSNEPIISPSWSPDGTKVAYVSFESKKPVVYVHDLVAGRRTVIS
NQKGNNSAPAWSPDGRHVAVSLSRDGNTQVYLVNADGSGLRRLSRSSAIDTEPSFSPDGR
YIYFTSDRGGAPQIYRMSVDGEESGGAQRVTFKGSYNTSPRVSPDGKLLAYISRVGGAFR
LYTQDLSNGDVNALTDTSNDESPSFAANGKFILYATRVGGKSVLAAVSTDGRTRQVLSLQ
AGEVREPAWGPFMQ