Protein Info for ABZR87_RS08980 in Ralstonia sp. UNC404CL21Col

Annotation: cell envelope integrity protein TolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details TIGR02794: protein TolA" amino acids 19 to 340 (322 residues), 180.5 bits, see alignment E=5.8e-57 PF13103: TonB_2" amino acids 255 to 338 (84 residues), 82 bits, see alignment E=1.4e-27 TIGR01352: TonB family C-terminal domain" amino acids 280 to 340 (61 residues), 34.8 bits, see alignment E=1.6e-12

Best Hits

KEGG orthology group: K03646, colicin import membrane protein (inferred from 97% identity to rpi:Rpic_0683)

Predicted SEED Role

"TolA protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>ABZR87_RS08980 cell envelope integrity protein TolA (Ralstonia sp. UNC404CL21Col)
MATTSLHRYEPVRERGTLRAFGLAVLTHILLLIFLYFGVQWQSSTPRGEEAELWDEAAVQ
QAVQQAAPVPDVKPEPVIKAPPAKVEEEADIALEQQKRKREQEAAAAREAELARRAAEAR
AEAQRQARLKEEQQARQAELQRKALAEQQAKEKAAEKAAADAAQARKNAQLQAQAEAKAK
AEADAKQKELKAKAAAEAKAKADAERKASESRANAQRQAQLDRLRAMAGAGATGTVAGSG
GGVGNAQGTGGTASAGYAERVRAKVKPNILFDPSAVNGNPSAVVSVQMAPDGSILSKRLT
KSSGNGAYDEAVMRAVERSDPLPRDTNGKAPSSVILTFRPKE