Protein Info for ABZR87_RS08970 in Ralstonia sp. UNC404CL21Col

Annotation: protein TolQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 15 to 42 (28 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details TIGR02796: protein TolQ" amino acids 11 to 227 (217 residues), 293.4 bits, see alignment E=5.4e-92 PF01618: MotA_ExbB" amino acids 84 to 215 (132 residues), 137.3 bits, see alignment E=1.3e-44

Best Hits

Swiss-Prot: 53% identical to TOLQ_PSEAE: Tol-Pal system protein TolQ (tolQ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03562, biopolymer transport protein TolQ (inferred from 100% identity to rpf:Rpic12D_0725)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>ABZR87_RS08970 protein TolQ (Ralstonia sp. UNC404CL21Col)
MNPVEVTQDLSIVSLVLHASLLVQFVMGLLLVMSLFSWTYIFRKAFALRAARSQTESFER
DFWAGGDLQALYQSAANNRHTTGALERIFEAGMREYLKARELQRGGGDPSAILDASRRAM
RAAYQREMDSLESHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVQQATLSAVAPGIA
EALVATAIGLFAAIPAVIAYNRYATEMDRLANRFESFMEEFSNILQRQTR