Protein Info for ABZR87_RS08870 in Ralstonia sp. UNC404CL21Col

Annotation: 6,7-dimethyl-8-ribityllumazine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00885: DMRL_synthase
  • amino acids 14 to 148 (135 residues), 165.7 bits, E=3e-53
• TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase
  • amino acids 15 to 147 (133 residues), 131.4 bits, E=1.2e-42

Best Hits

Swiss-Prot: 100% identical to RISB_RALPJ: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 100% identity to rpf:Rpic12D_0705)

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Protein Sequence (166 amino acids)

>ABZR87_RS08870 6,7-dimethyl-8-ribityllumazine synthase (Ralstonia sp. UNC404CL21Col)
MDHGFYPTNLNGEGLRIGIVQARFNEPVCEALREACVAELEQLGVAGEDVLLVTVPGALE
VPLALQKMAESGQFDALIALGAVIRGETYHFELVSNESGAGITRVGLDFNIAIANGILTT
DTDAQAHARTREKGRDCARTAVEMANLTNDLDGLQDHGQDDDGENE