Protein Info for ABZR87_RS08865 in Ralstonia sp. UNC404CL21Col

Annotation: transcription antitermination factor NusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 TIGR01951: transcription antitermination factor NusB" amino acids 18 to 145 (128 residues), 124.6 bits, see alignment E=1.5e-40 PF01029: NusB" amino acids 19 to 143 (125 residues), 114.8 bits, see alignment E=1.9e-37

Best Hits

Swiss-Prot: 99% identical to NUSB_RALPJ: Transcription antitermination protein NusB (nusB) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K03625, N utilization substance protein B (inferred from 99% identity to rpi:Rpic_0660)

Predicted SEED Role

"Transcription termination protein NusB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>ABZR87_RS08865 transcription antitermination factor NusB (Ralstonia sp. UNC404CL21Col)
MTQDNSQAKTKAPAKSARRRARELALQGLYQWLLNRNDPGVVEAHLQDAQGFNKADRAHF
DALLHGAIREETTLTEAFTPYLDRPVAELSPVERAALLVGAYELVHCVDIPYKVVINEAV
ELTKTFGGVEGYKYVNGVLDKLAAQVRAVEVAARR