Protein Info for ABZR87_RS08850 in Ralstonia sp. UNC404CL21Col

Annotation: 4-hydroxy-3-polyprenylbenzoate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00148: decarboxylase, UbiD family
  • amino acids 6 to 471 (466 residues), 522.1 bits, E=5.2e-161
• PF20695: UbiD_N
  • amino acids 10 to 92 (83 residues), 89.9 bits, E=1.4e-29
• PF01977: UbiD
  • amino acids 125 to 338 (214 residues), 255.4 bits, E=4.3e-80
• PF20696: UbiD_C
  • amino acids 344 to 468 (125 residues), 160.2 bits, E=3.7e-51

Best Hits

Swiss-Prot: 99% identical to UBID_RALPJ: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 99% identity to rpi:Rpic_0657)

MetaCyc: 68% identical to 3-octaprenyl-4-hydroxybenzoate decarboxylase (Escherichia coli K-12 substr. MG1655)
3-OCTAPRENYL-4-OHBENZOATE-DECARBOX-RXN [EC: 4.1.1.98]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (11/12 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (7/8 steps found)
• plastoquinol-9 biosynthesis II (1/5 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.98

Protein Sequence (503 amino acids)

>ABZR87_RS08850 4-hydroxy-3-polyprenylbenzoate decarboxylase (Ralstonia sp. UNC404CL21Col)
MQYRDLRDFLAQLERTGELRRVRQPVSPRLEMTEVCDRLLRSEGPAVVFEQPVDGAQKYD
MPVLANLFGTTRRVALGMGAESLDELRDVGRLLSALKEPEPPRGLREAGKLWTMAKAVWD
MAPRKVSSPACQEIVWEGNDVDLSRIPVQTCWPGDAAPLVTWGLVITRGPHKKRQNLGIY
RQQVISRNQVIMRWLAHRGGALDFREHAIANPGQPFPIAVALGADPATILGAVTPVPDTL
SEYQFAGLLRGSRTELATCLTPSLAQAQLQVPAGAEIILEGHIQPDPTHPSGYQHALEGP
FGDHTGYYNEQDWFPVFTVERITMRRDPIYHSTYTGKPPDEPAVLGVALNEVFVPLLQKQ
FPEIADFYLPPEGCSYRMALVSMKKQYAGHAKRVMFGVWSFLRQFMYTKFIVVVDDDVNL
RDWKEVIWAITTRVDPARDTVMVENTPIDYLDFASPVSGLGSKMGIDATNKWPGETTREW
GQPIVMDTAVKARVDAMWDTLFQ