Protein Info for ABZR87_RS08805 in Ralstonia sp. UNC404CL21Col

Annotation: tRNA (guanosine(46)-N7)-methyltransferase TrmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 TIGR00091: tRNA (guanine-N(7)-)-methyltransferase" amino acids 69 to 255 (187 residues), 179.4 bits, see alignment E=2.6e-57 PF02390: Methyltransf_4" amino acids 87 to 250 (164 residues), 186.2 bits, see alignment E=1.8e-59

Best Hits

Swiss-Prot: 96% identical to TRMB_RALPJ: tRNA (guanine-N(7)-)-methyltransferase (trmB) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K03439, tRNA (guanine-N7-)-methyltransferase [EC: 2.1.1.33] (inferred from 98% identity to rpf:Rpic12D_0612)

MetaCyc: 52% identical to tRNA m7G46 methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA (guanine-N(7)-)-methyltransferase. [EC: 2.1.1.33]

Predicted SEED Role

"tRNA (guanine46-N7-)-methyltransferase (EC 2.1.1.33)" (EC 2.1.1.33)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>ABZR87_RS08805 tRNA (guanosine(46)-N7)-methyltransferase TrmB (Ralstonia sp. UNC404CL21Col)
MQPIEQPGTGPDDITPESQDTHTAEGAETGAETGHPRRIRSFVRRAGRTSTGQQRAIDEL
GPRFLLPYAAEPLDWDAAFGRAGAKRIFEIGFGMGETTAHIAQLRPDDDFLGVEVHEPGV
GALLKLIGEREIGNIRIVSHDAVEVLAHMIPEGTLDGIHVFFPDPWHKKRHNKRRLIQSP
FVARLAAHLKPGGYLHCATDWEEYAHQMLEVLSAEPTLENTADGFAPRPDYRPVTKFEKR
GLRLGHGVWDVVFRKRA