Protein Info for ABZR87_RS08795 in Ralstonia sp. UNC404CL21Col

Annotation: undecaprenyl-diphosphate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 46 to 63 (18 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details TIGR00753: undecaprenyl-diphosphatase UppP" amino acids 9 to 277 (269 residues), 234.9 bits, see alignment E=6.3e-74 PF02673: BacA" amino acids 9 to 279 (271 residues), 296.8 bits, see alignment E=8e-93

Best Hits

Swiss-Prot: 100% identical to UPPP_RALPJ: Undecaprenyl-diphosphatase (uppP) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 100% identity to rpi:Rpic_0651)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>ABZR87_RS08795 undecaprenyl-diphosphate phosphatase (Ralstonia sp. UNC404CL21Col)
MDIALAIKALILGIVEGLTEFLPISSTGHLILAGQLLDFNDEKGKIFEIVIQFGAILAVC
WEFRHKIIDVIKGLPNDPRQQRFAINVIVATIPAITLALIFGKAIKAHLFNPIVVASAFI
LGGFVILWAEWRERHRGETHDPRANALLEAAKAGAPRIETLDDLRISDAIKVGFAQCFAL
IPGTSRSGSTIIGGLLFGLSRKVATEFSFFLAIPVIFGATVYELYKSRALLSADDLSIFA
VGFVAAFISAFFCVRWLLKFIATHDFRGFAWYRIIFGIIVLVTAYTHLIAWQA