Protein Info for ABZR87_RS08730 in Ralstonia sp. UNC404CL21Col

Annotation: nucleoside-diphosphate sugar epimerase/dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 162 to 166 (5 residues), see Phobius details PF13727: CoA_binding_3" amino acids 68 to 243 (176 residues), 29.9 bits, see alignment E=1.4e-10 PF04321: RmlD_sub_bind" amino acids 287 to 417 (131 residues), 38.7 bits, see alignment E=1.6e-13 PF02719: Polysacc_synt_2" amino acids 288 to 597 (310 residues), 398.6 bits, see alignment E=3.8e-123 PF01370: Epimerase" amino acids 288 to 520 (233 residues), 59 bits, see alignment E=1.2e-19 PF16363: GDP_Man_Dehyd" amino acids 289 to 416 (128 residues), 43.2 bits, see alignment E=9.1e-15

Best Hits

KEGG orthology group: None (inferred from 81% identity to rme:Rmet_2723)

Predicted SEED Role

"nucleotide sugar epimerase/dehydratase WbpM"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (647 amino acids)

>ABZR87_RS08730 nucleoside-diphosphate sugar epimerase/dehydratase (Ralstonia sp. UNC404CL21Col)
MNKLTIPLLALPRPVKRALVVLLDLVLSLVSVWIAFYLRIDQAGLPQLQQKCVYLLAPLL
AFPLFVRFGLYRAIFRYTGMSALASTAKAVGLYGVVFFLAILAFKWDGVPRSIGLIQPIL
FLLLVSGSRATARFWLAGQLGKGHHHGVGRLLIYGAGEAGVQTALALTVVREFVLLGYID
DDSSKVGRTINGLDIIGPEDVAEAVERMGITDILLAVPSLGRARRNAIIAKLRELPVHVR
TLPGMVDLASGRVTVRDIQELDIEDLLGRAPVPPDEALLARNLANKTVLVTGAGGSIGSE
LCRQILLERPHKLVLVEHSEFGLYSIHRELEGLRAEHRLSVEIVPLLASVANLDRLREVC
RAHQPQTVYHAAAYKHVPLVECNPSEGVLNNIFGTLNMARAAMESDAKYFVLVSTDKAVR
PTNIMGATKRMAELVLQALAASDAIDFGLLHGRSRDVVQNHTVFAMVRFGNVLGSSGSVV
PLFRRQLQEGGPLTVTHPEVTRYFMTIPEAAQLVLQAGAMAHGGEVFVLDMGQPVKIMDL
ARRMVQLSGLAVRDVDHPAGDIEIKVTGLRPGEKLYEELLIGDNPEGTVHERIMKAREHY
VPWPQFAPVLARMRVAAEEGDEPSIKEILKERVHGYEPQCTTTACAV