Protein Info for ABZR87_RS08715 in Ralstonia sp. UNC404CL21Col

Annotation: ATP-grasp domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF21360: PylC-like_N" amino acids 4 to 104 (101 residues), 85.3 bits, see alignment E=4e-28 PF02655: ATP-grasp_3" amino acids 114 to 269 (156 residues), 33.4 bits, see alignment E=7e-12 PF15632: ATPgrasp_Ter" amino acids 173 to 291 (119 residues), 54.9 bits, see alignment E=1.2e-18

Best Hits

KEGG orthology group: K01955, carbamoyl-phosphate synthase large subunit [EC: 6.3.5.5] (inferred from 65% identity to vap:Vapar_1935)

Predicted SEED Role

"Putative carbamoylphosphate synthase large subunit, short form"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>ABZR87_RS08715 ATP-grasp domain-containing protein (Ralstonia sp. UNC404CL21Col)
MNNVLLLSAGRRVELVEAFKIEMAKRNLEGHVCATDLQPRLSAACQIADRAFKAPRITDP
GYIDFLLETCLAEGIRLVVPTIDTELLLLAHNQSRFAAAGIHLIISDESLVALCRDKRKT
SDLFTELGIDTPRIYERSAITFPCFAKPYDGSCSVGAALLPRPDALTSAMLEDEKMMFME
YIDSTHVEYTVDAYYDRMGRLTCAVPRQRIEVRGGEVSKGATRRHFVYEYLLPRLAKLQG
ARGCITVQVFANEATGRFAALEINPRFGGGYPLSYSAGANYPGWLIDEYLLGHDIEFFDQ
WENNLLMLRYDAKVLVRDDI