Protein Info for ABZR87_RS08715 in Ralstonia sp. UNC404CL21Col

Annotation: ATP-grasp domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21360: PylC-like_N
  • amino acids 4 to 104 (101 residues), 85.6 bits, E=3.2e-28
• PF02655: ATP-grasp_3
  • amino acids 114 to 269 (156 residues), 33.4 bits, E=7e-12
• PF15632: ATPgrasp_Ter
  • amino acids 174 to 290 (117 residues), 54.3 bits, E=1.9e-18

Best Hits

KEGG orthology group: K01955, carbamoyl-phosphate synthase large subunit [EC: 6.3.5.5] (inferred from 65% identity to vap:Vapar_1935)

Predicted SEED Role

"Putative carbamoylphosphate synthase large subunit, short form"

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• UMP biosynthesis III (5/6 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Protein Sequence (320 amino acids)

>ABZR87_RS08715 ATP-grasp domain-containing protein (Ralstonia sp. UNC404CL21Col)
MNNVLLLSAGRRVELVEAFKIEMAKRNLEGHVCATDLQPRLSAACQIADRAFKAPRITDP
GYIDFLLETCLAEGIRLVVPTIDTELLLLAHNQSRFAAAGIHLIISDESLVALCRDKRKT
SDLFTELGIDTPRIYERSAITFPCFAKPYDGSCSVGAALLPRPDALTSAMLEDEKMMFME
YIDSTHVEYTVDAYYDRMGRLTCAVPRQRIEVRGGEVSKGATRRHFVYEYLLPRLAKLQG
ARGCITVQVFANEATGRFAALEINPRFGGGYPLSYSAGANYPGWLIDEYLLGHDIEFFDQ
WENNLLMLRYDAKVLVRDDI