Protein Info for ABZR87_RS08690 in Ralstonia sp. UNC404CL21Col

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 5 to 124 (120 residues), 34 bits, E=8.1e-12
• PF02719: Polysacc_synt_2
  • amino acids 6 to 280 (275 residues), 349.9 bits, E=4.9e-108
• PF05368: NmrA
  • amino acids 6 to 125 (120 residues), 26.6 bits, E=1.7e-09
• PF01370: Epimerase
  • amino acids 6 to 220 (215 residues), 93.9 bits, E=4.7e-30
• PF07993: NAD_binding_4
  • amino acids 7 to 140 (134 residues), 30.7 bits, E=7.9e-11
• PF01073: 3Beta_HSD
  • amino acids 7 to 128 (122 residues), 66.3 bits, E=1.1e-21
• PF16363: GDP_Man_Dehyd
  • amino acids 7 to 239 (233 residues), 56.4 bits, E=1.6e-18
• PF13460: NAD_binding_10
  • amino acids 9 to 126 (118 residues), 50.3 bits, E=1.3e-16
• PF08485: Polysacc_syn_2C
  • amino acids 283 to 333 (51 residues), 76.7 bits, 4e-25

Best Hits

Swiss-Prot: 64% identical to CAPD_RICAH: UDP-glucose 4-epimerase (capD) from Rickettsia akari (strain Hartford)

KEGG orthology group: None (inferred from 85% identity to ajs:Ajs_3026)

MetaCyc: 75% identical to UDP-N-acetylglucosamine 4,6-dehydratase (configuration-inverting) (Pseudomonas aeruginosa O11)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

• UDP-N-acetyl-β-L-fucosamine biosynthesis (2/4 steps found)
• UDP-N-acetyl-β-L-quinovosamine biosynthesis (1/4 steps found)
• CMP-pseudaminate biosynthesis (1/6 steps found)
• CMP-diacetamido-8-epilegionaminic acid biosynthesis (1/7 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (8/24 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Protein Sequence (345 amino acids)

>ABZR87_RS08690 polysaccharide biosynthesis protein (Ralstonia sp. UNC404CL21Col)
MKGILTITGGTGSFGNAVLKRFLDSEIDEIRVFSRDEKKQDDMRKRYASPKLKFYIGDVR
DRCSVDAVMRGVDYVYHAAALKQVPSCEFHPMEAVRTNVLGTENVLNAAVDAGVKRVVCL
STDKAVYPINAMGISKALMEKVMVAASRNLEGTNTVICGTRYGNVMASRGSVIPLFVDQV
LAGNPITVTDPTMTRFMMTLADAVDLVLYAFEHGNNGDIFVQKAPAATVDVLTKAILELM
RKPEHPVHVIGTRHGEKLYEALLSREEMACAEDMGDYFRVPPDGRDLNYAKFVEEGEQRL
TQSAHGEDYNSHNTTRLDVEGMKKLLLKLDFMQRIARGEHAVAED