Protein Info for ABZR87_RS08685 in Ralstonia sp. UNC404CL21Col

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 49 to 72 (24 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 115 to 140 (26 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 192 to 209 (18 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 320 to 343 (24 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 379 to 397 (19 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>ABZR87_RS08685 hypothetical protein (Ralstonia sp. UNC404CL21Col)
MMPFAIMASAMMPYLFSGLRPEHIVVPVLAGLALVMSGKDVRLNSNSRVLLFLAVFVLWV
GLGGVVLGSMFSDITGFDARPEAMFLRLCMPVLMLFSFVILLSRVPEALETTSRAIVWIA
IPAGLCAVLSALIDLSSLLAPWVQQDSGSVWENSVAIGRYPGLFNQPLEAGIFYSVALLA
QVYLIKYARRGIVVTALGLVVIVAGGMISFSKNFSLLGVVTALLFATWINLVGLWAVLLM
LVGGVIAIPVVISGLNPAYFDSLADLYREGGILMAISAGRLGSSETGVSQLFADLWDRDR
WILGRGLGSHLPLDSGYLEYFYQGGVLAIMGYLAFLVVLAIAAIRYRATAGGKLIGCLLV
LAVAGSIGGPVITASRASVAFMLLLAAAFVSIGTCSTNQIKGSLQ