Protein Info for ABZR87_RS08640 in Ralstonia sp. UNC404CL21Col

Annotation: symmetrical bis(5'-nucleosyl)-tetraphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF00149: Metallophos" amino acids 10 to 133 (124 residues), 34.4 bits, see alignment E=1.6e-12 TIGR00668: bis(5'-nucleosyl)-tetraphosphatase (symmetrical)" amino acids 10 to 256 (247 residues), 231 bits, see alignment E=9.9e-73

Best Hits

Swiss-Prot: 87% identical to APAH_RALSO: Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (apaH) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01525, bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [EC: 3.6.1.41] (inferred from 96% identity to rpf:Rpic12D_0573)

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (EC 3.6.1.41)" (EC 3.6.1.41)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>ABZR87_RS08640 symmetrical bis(5'-nucleosyl)-tetraphosphatase (Ralstonia sp. UNC404CL21Col)
MTSVSISPHAIGDLQGCCSPLQSLLAALPANAPLRFVGDLINRGPESLATLRQVIALCEA
GRARTVLGNHDIHLLAVAAGVRKPGKRDTIADILSAPDSDQLITWLRQQPLAIFENGFLM
VHAGVLPQWTTGDVLELAGAVERELRSPHWKTFLADAFGNHPDKWSNDLVGMDRLRLTIN
ALTRLRFCKPDGTMEFETTDADGAPDGHMPWFDVPGRRTRGTPIVFGHWSTRGLVMRDDV
MGLDTGCVWGGKLTAAKLSLAPAGRDVVQVECEQAQDPLAHKKK