Protein Info for ABZR87_RS08590 in Ralstonia sp. UNC404CL21Col

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 745 transmembrane" amino acids 76 to 94 (19 residues), see Phobius details amino acids 364 to 387 (24 residues), see Phobius details PF13675: PilJ" amino acids 97 to 201 (105 residues), 72 bits, see alignment E=4.4e-24 amino acids 230 to 322 (93 residues), 29.4 bits, see alignment E=7.1e-11 PF00015: MCPsignal" amino acids 527 to 710 (184 residues), 138.2 bits, see alignment E=2.6e-44

Best Hits

KEGG orthology group: K02660, twitching motility protein PilJ (inferred from 99% identity to rpi:Rpic_0615)

Predicted SEED Role

"twitching motility protein PilJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (745 amino acids)

>ABZR87_RS08590 methyl-accepting chemotaxis protein (Ralstonia sp. UNC404CL21Col)
MGFKWFNAGRRAGQAGAPEVAAEGASAASVQLAQLDNAPHADDDNPAGPPTQLGRSPMDA
VVGWMERVPFAAQQRVFTIGLVVGLLALLISVYLDNRQANNGSVQIEIAGDTLMHSQRLA
KAVPVALLGNTNAFAQLKESRARLQENLDALKNGNSERGVRASGGEAEALLDKSIEEWKR
SDKSAQAILAQEKTLVAVGKTLNVFNASNPELLEEAEQISSMKLQTNAPAREVAASSQLV
MLTQRLGKNMNEFLAGEGVNPETAFLLGKDTNTFRETLNGLLNGSEALRLSAATDAETKG
YLQELSTRFDNVQKTTQIILENLPGLIAAKRAQQQIFNDNEKLRADLSDLQSAYAGSVRS
RPVTLGAVVLSAILTVVCLAGLAALYLRDSRVRTMEAEARQREAEERRMVEKRNNDSTQA
AILRLMNELQDIADGDLTKQATVSEDITGAIADSVNYTVEELRELVGRVQQTAEQVTQAS
SAVQTTSESLVAASEEQSRQIRQTGQSVVEMADRITQVSRGAAESANVARASLAAAEQGQ
QAVQNAITGMNDIRDQIQETSKRIKRLGESSQEIGEIVELISDITEQTNVLALNAAIQAA
SAGEAGRGFSVVAEEVQRLAERSAEAAKQIGALIRTIQTDTQDAVHAMERSTAGVVEGAK
LSDNAGAALVEIGRVSRQLAELIESISQTTSHEATLASDVAQNIEQILHITEQTSTGTRQ
TAQSVRQLTQLAEELRDSVARFRIA