Protein Info for ABZR87_RS08525 in Ralstonia sp. UNC404CL21Col

Annotation: prepilin peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details PF01478: Peptidase_A24" amino acids 11 to 114 (104 residues), 72.4 bits, see alignment E=1.9e-24

Best Hits

KEGG orthology group: K02278, prepilin peptidase CpaA [EC: 3.4.23.43] (inferred from 82% identity to rsc:RCFBP_20757)

Predicted SEED Role

"Type IV prepilin peptidase TadV/CpaA" in subsystem Widespread colonization island

Isozymes

Compare fitness of predicted isozymes for: 3.4.23.43

Use Curated BLAST to search for 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>ABZR87_RS08525 prepilin peptidase (Ralstonia sp. UNC404CL21Col)
MTSLSALANLSLIVLIVMAAASDVRSRRIPNWLVASGLVAALLAQCLTQGFTAGALAWLG
GAAVGMGLCIGVYLLGGMGAGDVKLMGAIGAFMGPFGAFHIAFVSFLAGGVLALAMVLLR
RDAQRSFAGVSTLLMSLPFGGKAVPSPDSGGKRSGTIQLPYAVAFAAGTLLVKWGVL