Protein Info for ABZR87_RS08470 in Ralstonia sp. UNC404CL21Col

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 188 to 205 (18 residues), see Phobius details amino acids 243 to 268 (26 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 14 to 184 (171 residues), 31.9 bits, see alignment E=1.2e-11 PF00535: Glycos_transf_2" amino acids 15 to 177 (163 residues), 107.6 bits, see alignment E=6.6e-35

Best Hits

Swiss-Prot: 55% identical to Y501_SYNY3: Uncharacterized glycosyltransferase sll0501 (sll0501) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 99% identity to rpf:Rpic12D_0539)

MetaCyc: 56% identical to CPS-53 (KpLE1) prophage; bactoprenol glucosyl transferase (Escherichia coli K-12 substr. MG1655)
Phosphopolyprenol glucosyltransferase. [EC: 2.4.1.78]

Predicted SEED Role

"Glycosyl transferase, family 2"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.78

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>ABZR87_RS08470 glycosyltransferase family 2 protein (Ralstonia sp. UNC404CL21Col)
MQPNHQDPHDAPLLSLVVPFYNEGDALHLFFARVVPILESIDSMQFEIVCVNDGSADDTL
AKLVAVSHADPRVRVVDLTRNFGKEAALTAGLDDAQGDAVIPIDADLQDPPELIPTLVAH
WRKGAEVVLAQRANRACDSFLKRVTAAAYYRIHNRLSDLKLPENVGDFRLMDRAVVNALK
QLPERHRFMKGLFAWVGFSTVIVQYEREKRSAGTSKFSGWRLWNFALEGITSFSTLPLRS
WTYLGALVAALAFCYGAFIILRTMIFGVVVPGYASELSLMLFFGGLQMIGLGMIGEYVGR
IYDEAKGRPIYLVKRRYQERRPRTRVPSINNRQVIPIASARPRQPQGERQRSHAARR