Protein Info for ABZR87_RS08455 in Ralstonia sp. UNC404CL21Col

Annotation: YjgN family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details PF05987: DUF898" amino acids 25 to 353 (329 residues), 392.7 bits, see alignment E=7.1e-122

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpf:Rpic12D_0536)

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.9

Use Curated BLAST to search for 2.7.4.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>ABZR87_RS08455 YjgN family protein (Ralstonia sp. UNC404CL21Col)
MNDIARESVLGSAPGGPPAAASQPLRLRFIGSGSEYFRIWIVNLLLTIVTLGIYSAWAKV
RTLQYFYRNTQLAGSSFDYHGSPIAILKGRAIIFVLAFAFNLLGHSSPLLGLALLIVMAA
AFPWLLVRSLRFRMANSSYRGLRFAFTGKDAEGYMVFLVWPILSVLSLYLLAPLAHQRFK
RFQHKNTRFGTAQFDFSGTPGNFYGVYLRTFGLAILAFVVASCLALLLGVSLHRAPGVGQ
IFGFIVIGLFMYAAMLFLTPYFLSRLQNVVWNHTTLGAHRFQSQVGAGKLFWIFVSNAVL
ILITIGLFTPFARVRTARYKLDSVTMIAAGSLDTFVAGETTNVGALGDATVDWYDIDIAL