Protein Info for ABZR87_RS08395 in Ralstonia sp. UNC404CL21Col

Annotation: divalent metal cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 57 to 76 (20 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 134 to 151 (18 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 298 to 325 (28 residues), see Phobius details amino acids 346 to 365 (20 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details amino acids 406 to 428 (23 residues), see Phobius details PF01566: Nramp" amino acids 43 to 405 (363 residues), 266.6 bits, see alignment E=1.7e-83

Best Hits

KEGG orthology group: None (inferred from 81% identity to bpy:Bphyt_6311)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>ABZR87_RS08395 divalent metal cation transporter (Ralstonia sp. UNC404CL21Col)
MDGSGEARPNLYRVLRARLNAHPLSHVGPGLITGVADDDPSGIATYSQAGAQFGLEMLWT
MPLTFPLMAAMQSMCANMGRVTGKGLAANIKDVFPPIVLRTVVLLLLIANTLNIAADVAA
MGEVAELVSGIDRHVMTALVVFGTLALQIFVPYHRYVFFLKWLTASLLAYAAVLFTVHVP
WSRVALHTVWPSVRLDASAASMVVAVFGTTISPYLFFWQASEEVEDMRAHPSLKADGAKA
RTELRRIRWDTWSGMLYSNVTAYFIILATGVTLHVSGVTDITTAAQAASALRPLAGDFAY
VLFTVGILGVGLIGVPVLAGSGAYALSEAMGWKEGLERKVSDARGFYSIIALSVLAGLAI
QYSPIRPMKALFWSAVINGVVAVPLMAVIILLVSKPAVMGPYTASRPLIVLGWSATAIMG
VAAMAMFLL