Protein Info for ABZR87_RS08265 in Ralstonia sp. UNC404CL21Col

Annotation: paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 81 to 102 (22 residues), see Phobius details amino acids 129 to 156 (28 residues), see Phobius details amino acids 177 to 203 (27 residues), see Phobius details amino acids 209 to 226 (18 residues), see Phobius details PF04403: PqiA" amino acids 79 to 235 (157 residues), 176.3 bits, see alignment E=2.1e-56

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 95% identity to rpf:Rpic12D_0518)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>ABZR87_RS08265 paraquat-inducible protein A (Ralstonia sp. UNC404CL21Col)
MSSATTPASAQPAQQARPLRAAAHGLVTCERCGLLARMPESEAATRAVLTHEDAPDETAP
APVCPRCMSPLHVRKPDSLARCWALLIAAAAMYLPANLLPVMITDTLLGTQQDTIMSGIV
YLWTSGSWHLAIIVFIASFLVPLAKLGILAVLCLSVQQRWHWNPRLRTRLYALVEIIGRW
SMLDVFVVTLLAGLVHLSTLAIIKPGPGVGPFAAVVVLTMFAARCFDPRLIWDVIDEPDP
EETDV