Protein Info for ABZR87_RS08160 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 352 to 371 (20 residues), see Phobius details amino acids 377 to 379 (3 residues), see Phobius details amino acids 382 to 405 (24 residues), see Phobius details amino acids 417 to 436 (20 residues), see Phobius details PF07690: MFS_1" amino acids 40 to 402 (363 residues), 162.3 bits, see alignment E=7.8e-52

Best Hits

Swiss-Prot: 50% identical to TUB3_AGRVI: Putative tartrate transporter (ttuB) from Agrobacterium vitis

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_0497)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>ABZR87_RS08160 MFS transporter (Ralstonia sp. UNC404CL21Col)
MSQTQALPANPTDPASRPLPSTELDATYRRIAYRLVPFLVVLFILAWIDRVNVGFAKLSM
LQDLQFSEAVYGLGAGIFFIGYFLFEVPSNLLLEKIGARKTLARITILWGLASMAMIYVK
TPTSFYVMRFLLGIFEAGFFPGVVLYLTYWFPSAHRARINGLFMTSFAIAGVVGGPIAGF
IMSRMEGVGHLANWQWLFLLEGIPSVLAGFAVLAWLPETPRQAKWLSAAEQDAVVRAVEV
ENRDPAKHASFGAALANARVWICAAIYFCVVSGNATIAFWTPSIIKELGVQGNFQIGLIA
AIPFIAGTIAMVWNGAHSDRTGERRMHCAIAAVIAAAGLVATGALLGSPALALISLTVAA
IGILAAFPVFWSIPAVFLAGTAAAGGIALINSIGNLAGFVAPYMIGWLKTSTGRLSAGLY
FVAALELGAAVLVILGTRKH