Protein Info for ABZR87_RS08150 in Ralstonia sp. UNC404CL21Col

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 907 TIGR00229: PAS domain S-box protein" amino acids 30 to 150 (121 residues), 48.1 bits, see alignment E=1.2e-16 PF00989: PAS" amino acids 31 to 140 (110 residues), 35.5 bits, see alignment E=3.5e-12 PF13426: PAS_9" amino acids 40 to 142 (103 residues), 32.6 bits, see alignment E=3.3e-11 PF13185: GAF_2" amino acids 187 to 329 (143 residues), 49 bits, see alignment E=3e-16 PF01590: GAF" amino acids 187 to 328 (142 residues), 46.6 bits, see alignment E=2e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 472 to 638 (167 residues), 152.9 bits, see alignment E=6.5e-49 PF00990: GGDEF" amino acids 475 to 635 (161 residues), 172.5 bits, see alignment E=2.5e-54 PF00563: EAL" amino acids 657 to 889 (233 residues), 242.4 bits, see alignment E=1.8e-75

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpf:Rpic12D_0495)

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (907 amino acids)

>ABZR87_RS08150 EAL domain-containing protein (Ralstonia sp. UNC404CL21Col)
MDATSAERPDRPEPEVIDQDSPRPLPLADDRYEALVRQMPDALYIVADDIIVFVNEAGVR
LFGAQSARDIVGHELDEFVHDNSMHLARQRREWMVAHGAGLPPVEQTLLRCDGTPVEVEV
LSAPVQLGWRTAIQVVARDITQRKQAEQALRESEANYRALAAETARAKELLRCEKTVLEL
SSRNVPLPDLLAEVCRLVEALLDDGAMCSVLLSSDGEHITQAVAPSLPFMLSQVLVGIAI
GPAVGSCGTAMFLNKTVVVEDIDADPLWDGYRDIVAPLGLRACWSTPIRGDNAQMIGAMG
IYYDTPRAPTRDAMGLLDGITDIIGVAVQKAHIARDLQESEERYRLAVDNLTEGIVVQAA
DGTILACNPSARRILRAGNLSPVGTSHLALMRRSLREDGSEIPLNERPTRVVLTTGRPLL
GLTVGLELVDGDVVWVHENVLPIVRPGDDAPSAVLISFNDIGPARAAQQQLTFLAQRDAL
TGLYNRAYFSQRMQAVMEQAASQAGEARQVAVLFLDLDGFKKVNDTAGHEAGDHLLRIVA
QRLSACVRQSDTLARLGGDEFVVLLDNVRSLGEAERLAKRIVHSIAQPFSTGGTEYYLGA
SIGIAVYPEHGNDAATLLRCADAAMYNAKQNGRNQHRVYTARLSQRAQRRFQLEYHLRRA
LAAGELSLRFQPIVDATSMDIVGAEVLLRWHSTELGEVSPAEFIPVAEDAGLIGDIGEWV
LAQACHQAAHWRATCMPDFFVAVNLSPRQFGEGLVPTISRCLAEAGLPASALEMEITEGL
LMRDTAAVMPVLDALTALGIRISIDDFGTGYSSLSYLQRFPIDNLKVDRSFVSGIPRHRD
SVVISRAIVAMAASLDMTVTAEGVETLEQAEFLQAAGCDKLQGFLFGPPMTAGAYEARLR
RNRPAQA