Protein Info for ABZR87_RS08090 in Ralstonia sp. UNC404CL21Col

Annotation: 5-(carboxyamino)imidazole ribonucleotide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF22660: RS_preATP-grasp-like" amino acids 32 to 127 (96 residues), 101.8 bits, see alignment E=3.4e-33 TIGR01161: phosphoribosylaminoimidazole carboxylase, ATPase subunit" amino acids 32 to 395 (364 residues), 363.5 bits, see alignment E=6.8e-113 PF02222: ATP-grasp" amino acids 141 to 315 (175 residues), 160.1 bits, see alignment E=7.2e-51 PF17769: PurK_C" amino acids 338 to 397 (60 residues), 63.5 bits, see alignment E=1.8e-21

Best Hits

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 98% identity to rpi:Rpic_0496)

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>ABZR87_RS08090 5-(carboxyamino)imidazole ribonucleotide synthase (Ralstonia sp. UNC404CL21Col)
MADDLNPRLAQAHTAESRALNVPNAILPDAWLGMLGGGQLGRMFAHAAQAMGYKVCVLDP
DPNSPAGTIAERHLCAGYTDEAALAEMAALCPAVTTEFENVPAMALDRLEQLGAFVAPRA
NCVSIAQNRIAEKKFFALCAARTGIHPAPSWVIEHEADIEQLPADLLPGILKIARMGYDG
KGQARVSTVEELRAAWAAMQHVPCVLEKMLPLAYEVSVLAARGADGSTATWPLAENAHRD
GILFSTIMPSRSVSDDIATRTRAAAAMIAEEMGYVGVLCIEFFVLQDGSLVANEMAPRPH
NSGHITMDVCETSQFEQQVRAMARLPLGSTRQHSPGRMLNVLGDVWFEYGLERTPAWHEV
MGHSGAKVHLYGKADARPGRKMGHVNCVGTSPEVVDEAFRHAAHVLGLQPD