Protein Info for ABZR87_RS08060 in Ralstonia sp. UNC404CL21Col

Annotation: EamA family transporter RarD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 127 to 144 (18 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details PF00892: EamA" amino acids 7 to 143 (137 residues), 54.8 bits, see alignment E=5.9e-19 TIGR00688: protein RarD" amino acids 7 to 260 (254 residues), 243.9 bits, see alignment E=9.4e-77

Best Hits

Swiss-Prot: 48% identical to RARD_STREX: Protein RarD (rarD) from Streptomyces exfoliatus

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 98% identity to rpi:Rpic_0490)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>ABZR87_RS08060 EamA family transporter RarD (Ralstonia sp. UNC404CL21Col)
MSASNRNGVIFAFLAYTMWGLFPLYFKLLKAVSPVEILSHRVIWSLAVMVVILLVKRHGA
WLWALRKQPRVVGRYAASTSLLATNWLTYIWAVNHDHVLEASLGYFINPLVVVMLAALVL
GERLRPVQWVSVALAAAGVAWLTWQAGTLPWIALALAFSFGFYGLLRKTSPLGALEGLTL
ETLLLFPLALAYLGWLASQHQNAFLAASPGTQLLLALAGPLTALPLLLFGAGARRIPLSL
LGLLQYVSPTLQLLLGVWLYNEPFAGPKVAGYVLIWAGLAVYSAESWMQLRRRTPLPA