Protein Info for ABZR87_RS08005 in Ralstonia sp. UNC404CL21Col

Annotation: O-antigen ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 217 to 233 (17 residues), see Phobius details amino acids 242 to 266 (25 residues), see Phobius details amino acids 335 to 358 (24 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 389 to 406 (18 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details PF15864: PglL_A" amino acids 163 to 187 (25 residues), 42.2 bits, see alignment (E = 7.6e-15) PF04932: Wzy_C" amino acids 202 to 350 (149 residues), 62 bits, see alignment E=8.9e-21 PF11846: Wzy_C_2" amino acids 372 to 534 (163 residues), 128.5 bits, see alignment E=4.8e-41

Best Hits

KEGG orthology group: None (inferred from 61% identity to rsc:RCFBP_20915)

Predicted SEED Role

"Lipid A core - O-antigen ligase and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (574 amino acids)

>ABZR87_RS08005 O-antigen ligase family protein (Ralstonia sp. UNC404CL21Col)
MPRSPALLIPLSLAVAACWSIPFLVAPHTYPIPTFYGEFASAVCWAVLAVVALGATWREK
VVFPVAALAPVALVLVLIVQLDVATPINPFYSFAAIVFLLAAAAATGIGARCREIPGVLR
AIAVGVLIGALLTVAIELLQLFRVQGLPESLVSPASTALDRRMWGNLNQPNHVASYLSFG
LAACVYLANGSKLVRAFLVGCALMFLVGMALTFSRTAWIHTGIVGVLTGLLFWKQRGGHK
GWAIATPLLLLLVFELCNWLVSYANMLWALGLPTSLATRMEHGASDRMPMWHHAWHMFVT
NFWLGGGWGDYAWNQYVQTDLLGPVTMSLNAHNAVLDILAKVGIFGLLAVVLPLAGLVRV
AIRSSFTSASVFLYTVVLVLAAHSMLEYPLQYLYFLLPFAFVLGYADDRPLRFPSASMAW
VLTGIIVVCCIALTGRMWIDYKPIEQLYYQQGGAQAALRQYQESKQLLLAPYANLTIANN
AGMTYELAPVLAAIERQAVQFYPSAGPVQRWAVALAFQGKTDEAVLQVRRLRDLNSEDYV
GASLLIAHVCKEKMVGSKEFCTRLKAKNLLTGVD