Protein Info for ABZR87_RS07990 in Ralstonia sp. UNC404CL21Col

Annotation: TerC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 104 to 128 (25 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details TIGR03717: integral membrane protein, YjbE family" amino acids 12 to 190 (179 residues), 226.8 bits, see alignment E=7.8e-72 PF03741: TerC" amino acids 14 to 189 (176 residues), 162.1 bits, see alignment E=6e-52

Best Hits

KEGG orthology group: None (inferred from 96% identity to rpi:Rpic_0476)

Predicted SEED Role

"Membrane protein TerC, possibly involved in tellurium resistance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>ABZR87_RS07990 TerC family protein (Ralstonia sp. UNC404CL21Col)
MALTSSAFWFALGSIILTNIVLSGDNAVVIALAARNLPKRQQKQAIFWGSAGAIVLRVVL
TVLAVKLLALPYLKTIGAVLLVYIGVKLLAEADEEAADRHQRAGLWAAIQTILIADFVMS
LDNVVAVAAAAEKGPPGTTFLLLVLGLGLSVPLIVFGSTLLVGVMARFPVIITLGAALLG
YLAGDMLVTDPIDAAWFERAVPYADVVVGCVGALLVVSVGRWLSRRTLRQA