Protein Info for ABZR87_RS07985 in Ralstonia sp. UNC404CL21Col

Annotation: succinate--CoA ligase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01019: succinate-CoA ligase, alpha subunit
  • amino acids 3 to 293 (291 residues), 419 bits, E=5.1e-130
• PF02629: CoA_binding
  • amino acids 6 to 102 (97 residues), 87.1 bits, E=1.7e-28
• PF13607: Succ_CoA_lig
  • amino acids 150 to 291 (142 residues), 36.1 bits, E=7.9e-13
• PF00549: Ligase_CoA
  • amino acids 156 to 267 (112 residues), 76.6 bits, E=3e-25

Best Hits

Swiss-Prot: 63% identical to SUCD_STAAS: Succinate--CoA ligase [ADP-forming] subunit alpha (sucD) from Staphylococcus aureus (strain MSSA476)

KEGG orthology group: K01902, succinyl-CoA synthetase alpha subunit [EC: 6.2.1.5] (inferred from 99% identity to rsc:RCFBP_20919)

MetaCyc: 86% identical to 3-sulfinopropionyl-CoA synthetase alpha subunit (Advenella mimigardefordensis DPN7)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]; 6.2.1.- [EC: 6.2.1.5]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• adipate degradation (5/5 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• adipate biosynthesis (4/5 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• TCA cycle III (animals) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• 3,3'-disulfanediyldipropannoate degradation (2/4 steps found)
• pyruvate fermentation to acetate VI (1/3 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• reductive TCA cycle II (6/12 steps found)
• methylaspartate cycle (11/19 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (18/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• C5-Branched dibasic acid metabolism
• Citrate cycle (TCA cycle)
• Propanoate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.5

Protein Sequence (293 amino acids)

>ABZR87_RS07985 succinate--CoA ligase subunit alpha (Ralstonia sp. UNC404CL21Col)
MSILINKDTKVITQGITGKTGQFHTRGCRDYANGKNCFVAGVNPKKAGEDFEGIPIYATV
KDAKAQTGATVSVIYVPPAGAADAIWEAVEAELDLVVCITEGIPVRDMMMVKDKMRKAGS
KTLLLGPNCPGLITPDEIKIGIMPGHIHRKGRIGVVSRSGTLTYEAVGQLTALGLGQSSA
VGIGGDPINGLKHIDVMKMFNDDPETDAVVMIGEIGGPDEANAAYWIKDNMKKPVVGFIA
GVTAPPGKRMGHAGALISGGADTAQAKLDIMEECGIKTTKNPSEMARLLKAML