Protein Info for ABZR87_RS07940 in Ralstonia sp. UNC404CL21Col

Annotation: DUF294 nucleotidyltransferase-like domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 PF00027: cNMP_binding" amino acids 31 to 111 (81 residues), 44 bits, see alignment E=3.5e-15 PF00571: CBS" amino acids 146 to 202 (57 residues), 17.8 bits, see alignment 7.1e-07 amino acids 220 to 267 (48 residues), 29.3 bits, see alignment 1.8e-10 PF03445: DUF294" amino acids 292 to 423 (132 residues), 134 bits, see alignment E=6.9e-43 PF10335: DUF294_C" amino acids 462 to 602 (141 residues), 121.8 bits, see alignment E=4e-39

Best Hits

KEGG orthology group: K07182, CBS domain-containing protein (inferred from 94% identity to rpi:Rpic_0466)

Predicted SEED Role

"Predicted signal-transduction protein containing cAMP-binding and CBS domains" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (608 amino acids)

>ABZR87_RS07940 DUF294 nucleotidyltransferase-like domain-containing protein (Ralstonia sp. UNC404CL21Col)
MPSAFNFNVWPFDCLDQDEQRLVRDAVDIGYYPEGQTLLDTGAAPLHLFLIIKGHVAQYD
GDELIATYGPDDCFDGRALVAGKASSRFVAAEEVVVYQIARQAVRDLIAANATFGALLFS
DLGSKLSAIAQRQNMETMQSLAVSHVSDAFIRPAHFVDADTDVVSVVKLFQAHNTSNVLV
RDGTGSPPRVGIFTRSSLQRAVLQGTPLDRLPVGQMSQFSLITVPASAHIGDALTLMLRH
RVHRLVVTHGDEILGLLESLDVFSFLANHSYLLTVQINLAQDLDALAQAAAKITRMVALL
TRGGSRIDHVASLVREINARLFERAWQMIAPPELVENSCLFVMGSEGRGEQLLKTDQDNA
LVLRDGYVPPADLQRIVTRFSDALAAFGYPPCPGGIMLSRPEWCMAASDFARRIREWLIL
PSPEGLMRLAIFFDAHAVCGDAALLRQLRRTLLELTIDNDAVLGRFAAAVEAFSVAPGWR
DRLLGFGDSDPVIDVKKEGIFPIVHGVRSLALAHQILDETGTVPRLEALVRAEAVDAHMA
AELSDSLHFLMSLRLKAGLAEVDARQPLSCDVHLARLSSLERDLLKDALGAVKRFKALLQ
QRWRTEWM