Protein Info for ABZR87_RS07935 in Ralstonia sp. UNC404CL21Col

Annotation: cation acetate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details amino acids 318 to 344 (27 residues), see Phobius details amino acids 380 to 407 (28 residues), see Phobius details amino acids 429 to 448 (20 residues), see Phobius details amino acids 454 to 475 (22 residues), see Phobius details amino acids 486 to 508 (23 residues), see Phobius details amino acids 521 to 544 (24 residues), see Phobius details PF00474: SSF" amino acids 68 to 493 (426 residues), 387.7 bits, see alignment E=3.1e-120 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 68 to 493 (426 residues), 206.7 bits, see alignment E=3.1e-65

Best Hits

KEGG orthology group: K14393, cation/acetate symporter (inferred from 99% identity to rpf:Rpic12D_0449)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (576 amino acids)

>ABZR87_RS07935 cation acetate symporter (Ralstonia sp. UNC404CL21Col)
MKKMLSILLAALLAAGACGAAFAAGGDVGQTAKQETNTTAIVLFALFVAGTLWITKWAAK
RTRSAADFYTAGGGITGFQNGLAISGDYMSAASFLGISAAVMTSGYDGLIYSIGFLVGWP
IITFLMAERLRNLGKFTFADVAGYRFEQGPIRSFAAVGTLVVVAFYLIAQMVGAGQLIKL
LFGLDYWIAVVIVGALMMVYVLFGGMTATTWVQIIKACLLLAGVTFMAIMVLAQYGFSLE
VLFAKAVQVKTAIAANAGKSPDEAAKIGLAVMAPGGFIKDPISAISFGMALMFGTAGLPH
ILMRFFTVPDAKEARKSVFWATTWIGYFYILIFVIGFGAITLVLTNPELSDVAKGVIKGG
AGTANMAAVLVAKTVGGDVFYGFISAVAFATILAVVAGLTLSGASAVSHDLYATVFKNGK
ANSADELKVSRITTLVLGVIAVLLGIAFEKQNIAFMVSLAFAVAASANFPVLFLSMLWKG
CTTRGAVIGGFLGLISSVGLTIVSPSVWEATLGYPKGSAWFPYTSPALFSMTIGFVGVWL
FSVLDSSVRAKNEKASFAAQQVRSETGLGAAGASGH