Protein Info for ABZR87_RS07910 in Ralstonia sp. UNC404CL21Col

Annotation: NAD(P)/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 PF07992: Pyr_redox_2" amino acids 26 to 247 (222 residues), 29.7 bits, see alignment E=9.1e-11 PF13450: NAD_binding_8" amino acids 29 to 77 (49 residues), 34.5 bits, see alignment 4.1e-12 PF00743: FMO-like" amino acids 99 to 242 (144 residues), 51 bits, see alignment E=1.7e-17

Best Hits

Swiss-Prot: 53% identical to ETHA_MYCS2: FAD-containing monooxygenase EthA (ethA) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: None (inferred from 96% identity to rpi:Rpic_0433)

MetaCyc: 58% identical to ethionamide monooxygenase EthA (Mycobacterium tuberculosis H37Rv)
1.14.13.-; 1.14.13.-; 1.14.13.-

Predicted SEED Role

"Cyclohexanone monooxygenase (EC 1.14.13.22)" (EC 1.14.13.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.22

Use Curated BLAST to search for 1.14.13.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (516 amino acids)

>ABZR87_RS07910 NAD(P)/FAD-dependent oxidoreductase (Ralstonia sp. UNC404CL21Col)
MDTTMEHSASRAAPRNRAAAPDTDLDVLIVGAGLSGIGAAYHLRERCPSARFTILEGRET
IGGTWDLFRYPGIRSDSDMFTLGYSFRPWHSNKAISDGQTILDYIRDTARVFGIDKSIRF
RHKVTGASWDSTAARWTVQALRSDGTREEPVQFTCKFLYMCSGYYDYEEGHAPTWPEMDA
FQGRIVHPQHWPSDLSYAGKRVVVIGSGATAVTLVPAMAGTAQHVTMLQRSPTYIVSRPE
QDAVANTLRRWLPSGLAHRLVRTKNVLLTMYFYSLARRKPKAFKDFIIRMAGKQIGPGFD
VRKHLTPRYNPWDQRLCLVPDGDLFKTIRAGKASIATDEIARFTPTGLQLKSGEHLDADV
IVTATGLKLKVLGGAAITVDGRAVNLAETVSYKGMMYSGVPNLASSFGYTNASWTLKAEL
IAQYVCRLLNHMQANGFDTCVPRLDDEAMSREPAVDLTSGYIQRAAAILPKQGDKQPWKS
YQNYARDLMMLKFGTLADSAMQFERRAQPIGAAQPA