Protein Info for ABZR87_RS07780 in Ralstonia sp. UNC404CL21Col

Annotation: tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF00919: UPF0004" amino acids 3 to 103 (101 residues), 103.2 bits, see alignment E=9.5e-34 TIGR01574: tRNA-i(6)A37 thiotransferase enzyme MiaB" amino acids 3 to 446 (444 residues), 573 bits, see alignment E=4.6e-176 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 3 to 444 (442 residues), 485.8 bits, see alignment E=1.1e-149 PF04055: Radical_SAM" amino acids 150 to 325 (176 residues), 96.4 bits, see alignment E=3.3e-31 PF01938: TRAM" amino acids 380 to 446 (67 residues), 43.3 bits, see alignment E=4e-15

Best Hits

Swiss-Prot: 98% identical to MIAB_RALPJ: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (miaB) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K06168, bifunctional enzyme involved in thiolation and methylation of tRNA (inferred from 100% identity to rpf:Rpic12D_0423)

MetaCyc: 63% identical to isopentenyl-adenosine A37 tRNA methylthiolase (Escherichia coli K-12 substr. MG1655)
RXN0-5063 [EC: 2.8.4.3]

Predicted SEED Role

"tRNA-i(6)A37 methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase or tRNA processing

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.4.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>ABZR87_RS07780 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB (Ralstonia sp. UNC404CL21Col)
MKKVFIKTYGCQMNEYDSDKMSDVLNAAEGLVPTDTPEDADVILFNTCSVREKAQEKVFS
ELGRVKALKALKPDLVVGVGGCVASQEGASIVARAPYVDVVFGPQTLHRLPDLIAARRRT
GRSQVDVSFPEIEKFDHLPPARVDGASAFVSIMEGCSKYCSYCVVPYTRGEEVSRPFDDV
LAEVAGLAEQGVREVTLLGQNVNAYIGKMGDTSERADFALLLEYVAEIPGIERIRYTTSH
PKEFSSRLIEAYATNPKLVDHLHLPVQHGSDRILMAMKRGYTVLEYKSSIRKLRAIRPNI
SIATDFIVGFPGETDADFAKTMDLIHEIGYDTSFSFIYSPRPGTPAANLPDDTPQAVKLE
RLKHLQATIEENVARISQGMVGSVQRILVEGPSRKDPTELHGRTENNRVVNFALPDLPQA
RRDQLIGQMLDVRIVHAFPHSLRGEVAEQRTASTTH