Protein Info for ABZR87_RS07685 in Ralstonia sp. UNC404CL21Col

Annotation: AzlC family ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 65 (26 residues), see Phobius details amino acids 68 to 95 (28 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 192 to 208 (17 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details PF03591: AzlC" amino acids 18 to 163 (146 residues), 146.5 bits, see alignment E=3.4e-47

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpi:Rpic_0389)

Predicted SEED Role

"Branched-chain amino acid transport protein AzlC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>ABZR87_RS07685 AzlC family ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MASPRAVEFRAGMLALAPMLLGVVPFGMIYGVLATSAGMPAWLAVAMSAIVFGGASQMIL
VQLWAGGAPALVIAATVSMVNLRHALYSASIAPALAHLPRRWKWLIAYLLTDEAFAAMNR
RVVTAQPGSAEAAYRHWYFLGAGVALWSSWQASTIVGVVLGAQVPTSWPLDFFLPLTFIA
IVVPALRTRAQLAAALAGAALAVAWTGWPHKLGLMSAACVGIAVGALVERLVARPSDKGA
AA