Protein Info for ABZR87_RS07600 in Ralstonia sp. UNC404CL21Col

Annotation: tyrosine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 TIGR00234: tyrosine--tRNA ligase" amino acids 44 to 420 (377 residues), 390 bits, see alignment E=7.2e-121 PF00579: tRNA-synt_1b" amino acids 59 to 339 (281 residues), 267.6 bits, see alignment E=1.4e-83 PF01479: S4" amino acids 362 to 405 (44 residues), 29.2 bits, see alignment 6.4e-11

Best Hits

Swiss-Prot: 97% identical to SYY_RALSO: Tyrosine--tRNA ligase (tyrS) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 98% identity to rpf:Rpic12D_0387)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>ABZR87_RS07600 tyrosine--tRNA ligase (Ralstonia sp. UNC404CL21Col)
MTASATSAASDNATPGKPKYPVTPEVAHAMEVSLRGCDELLIAAEWEQKLAKSAATGVPL
RIKLGLDPTAPDIHIGHTVVLNKMRQLQDLGHQVIFLIGDFTSTIGDPSGRNATRPPLTR
EQIEANAQTYYRQASMVLDPSKTEIRYNSEWCDPLGARGIIQLAAKYTVARMMERDDFTK
RYKAGVPISVHEFLYPLMQGYDSVALKSDLELGGTDQKFNLLVGRELQKEYGQEPQCILT
MPLLVGIDGVEKMSKSKGNYVGISEAPNEMFGKLMSISDDLMWTYYTLLSFRPLAEIDLM
KQEIALGRNPRDCKVMLAQEIVARFHSQADAERALEDFNHRARGGVPDDIPQIELSGAPL
GIAQLLKQAGLCPSTSDANRNIEQGGVKIDGTVISDKALKIDAGTFVMQVGKRRFARVVL
K