Protein Info for ABZR87_RS07540 in Ralstonia sp. UNC404CL21Col

Annotation: class II glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF13230: GATase_4" amino acids 1 to 264 (264 residues), 409.8 bits, see alignment E=1.9e-127

Best Hits

Swiss-Prot: 52% identical to Y1037_HAEIN: Putative glutamine amidotransferase HI_1037 (HI_1037) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07008, glutamine amidotransferase (inferred from 100% identity to rpi:Rpic_0361)

Predicted SEED Role

"Glutamine amidotransferase, class-II" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>ABZR87_RS07540 class II glutamine amidotransferase (Ralstonia sp. UNC404CL21Col)
MCQLLGMNCAEPTDVTFSFTGFAARGGVTDHHADGFGVAFFEDKACRLFIDNQSAGTSPV
AELVKRYPIKSKNVISHIRKATQGTVRLENCHPFMRELWGRHWIFAHNGDLKNFSPFLSG
VYQPVGDTDSELAFCFIMQALRKRFPGSQPPLNELFYALSDITKEITRYGVFNFLLCNGQ
AQFAHCSTRLYYIVRQWPFSTAHLIDADMTIDFAKYTTPADRVAVIATAPLTDNEVWTQF
VPGELLMFESGQATMATKVPIPEAVQIANAANTACT