Protein Info for ABZR87_RS07530 in Ralstonia sp. UNC404CL21Col

Annotation: glutamate/aspartate ABC transporter permease GltK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 120 (106 residues), 78.2 bits, see alignment E=2.8e-26 PF00528: BPD_transp_1" amino acids 36 to 226 (191 residues), 72.9 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 65% identical to GLTK_ECO57: Glutamate/aspartate import permease protein GltK (gltK) from Escherichia coli O157:H7

KEGG orthology group: K10002, glutamate/aspartate transport system permease protein (inferred from 95% identity to rsc:RCFBP_21000)

MetaCyc: 65% identical to glutamate/aspartate ABC transporter membrane subunit GltK (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>ABZR87_RS07530 glutamate/aspartate ABC transporter permease GltK (Ralstonia sp. UNC404CL21Col)
MAYHFDFSSINADNMRVLGEGMLLSLEITGTAILVGIVWGTLLAMMRLSGIKPLQWFGQG
YVNLFRSIPLVMVLLWFFLIVPQVLQRIFNLSPATDMRMTSALVAFALFEAAYYSEIIRA
GIQSVSRGQMFAAYAMGMTYGQAMRLVILPQAFRNMIPLLLTQAIVLFQDTSLVYVSALS
DFFTQAYNIGERDGRIVELLLFAGLCYFVICFGASVLVKRLQKKVTQ