Protein Info for ABZR87_RS07505 in Ralstonia sp. UNC404CL21Col

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 613 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details PF00664: ABC_membrane" amino acids 38 to 311 (274 residues), 153.5 bits, see alignment E=1.4e-48 PF00005: ABC_tran" amino acids 377 to 525 (149 residues), 113.8 bits, see alignment E=1.5e-36

Best Hits

Swiss-Prot: 48% identical to ATM1_NOVAD: ATM1-type heavy metal exporter (atm1) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 98% identity to rpi:Rpic_0354)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (613 amino acids)

>ABZR87_RS07505 ABC transporter ATP-binding protein/permease (Ralstonia sp. UNC404CL21Col)
MRRFPASSEPPPPGAARGDWRTIKSLLPYLMAYKWRVALALSFLIAAKVANLGVPMVMKR
LIDSMNVSPSDPRALLVVPVGIIIGYGLLRLSTSLFSELREILFAKVTESSVRTLALQVF
RHLHALSLRFHLERQTGGMSRDIERGTRGIQSLISYSLYSILPTLVEVGLVITYFFVKYD
VWFALITFCALVSYIVFTVTVTNWRTHFRRKMNELDSRANQKAIDSLLNFETVKYFGNED
YEARRYDENLKHYRAAAIRSQNSLSVLNFGQQFIVATALILILYRATQGVAAGHMTLGDL
VLVNTLMLQIYIPLNFLGVIYRELKQAVTDMDRMFNLLQTNREVADKPDAKPLAVHAGEV
RFAHVDFGYEANRQILFDVDFTIPAGTTTAVVGQSGSGKSTLARLLFRFYDVKSGAIQID
GQDLRDVTQSSVRAAIGIVPQDTVLFNDSIYYNIAYGRPDASREEVIEAARAAQIHHFVE
SLPDGYETQVGERGLKLSGGEKQRVAIARTLLKRPPILVFDEATSALDSRTEHAIQEELM
RLAQNHTTLVIAHRLSTIVRAHQILVMEHGRIIERGTHESLLRAEGRYAQMWRMQAREPE
RVAEETEEDARAG