Protein Info for ABZR87_RS07415 in Ralstonia sp. UNC404CL21Col

Annotation: ubiquinone biosynthesis regulatory protein kinase UbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 498 to 522 (25 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 4 to 442 (439 residues), 564.5 bits, see alignment E=6.6e-174 PF03109: ABC1" amino acids 88 to 339 (252 residues), 252.8 bits, see alignment E=2.7e-79 PF27536: UbiB_N" amino acids 361 to 422 (62 residues), 96.1 bits, see alignment E=7.3e-32

Best Hits

Swiss-Prot: 92% identical to UBIB_RALSO: Probable protein kinase UbiB (ubiB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 99% identity to rpi:Rpic_0336)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (525 amino acids)

>ABZR87_RS07415 ubiquinone biosynthesis regulatory protein kinase UbiB (Ralstonia sp. UNC404CL21Col)
MTRFFRLGKIVFVILYYGLDQLALSGFKSRRIRALVWLLTLGRKPKLPRGVRLRLALEQL
GPIFVKFGQVLSTRRDLLPPDVADELAKLQDRVPPFDPKVAAAIVEKSLGKPLSALFHRF
DHHPVASASIAQVHFATLRGGPYDGREVAVKVLRPGMLPVIDSDLALMRDLATWMEKLWA
DAKRLKPREVVAEFDKYLHDELDLMREAANASQLRRNFAKSDLLLVPEVFWDWCTSEVFV
MERMHGMRISHTEELRAAGVDMHKLARDGVEIFFTQVFRDGFFHADMHPGNILVSVAPET
LGRYIALDFGIVGALSEFDKNYLAQNFLAFFQRDYHRVAVLHIESGWAPEETRVEELEGA
IRACCEPYFDRPLGEISLGLVLMRLFQTSRRFNVEVQPQLVLLQKTLLNVEGLGRQLDPD
LDLWKTAKPFLERWMHEQIGWRGFVERLKVEAPQWANKLPDFPRLMHQILDRHSREDGNA
QTAALTALLAEQKRTNRLLSAALLFVGGFAVGIIATHVLAWMSRY