Protein Info for ABZR87_RS07370 in Ralstonia sp. UNC404CL21Col

Annotation: nucleoside recognition domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details amino acids 390 to 414 (25 residues), see Phobius details PF07670: Gate" amino acids 49 to 160 (112 residues), 44.4 bits, see alignment E=1e-15 amino acids 282 to 386 (105 residues), 47.9 bits, see alignment E=8.3e-17

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_0342)

Predicted SEED Role

"Fused spore maturation proteins A and B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>ABZR87_RS07370 nucleoside recognition domain-containing protein (Ralstonia sp. UNC404CL21Col)
MALNLVWLAFFLVAFVTACVQVVQGDMEVFSRMLTGMFDAARTGFEIAIGLTGMMALWLG
IMRVGERAGVVDLFARLVNPVMRHLFPSVPAGHPANGAMMMNVSANVLGLDNAATPLGLQ
AMRELQQINPQPQRASDAQLMFVVLNTAGVTLVPTSVIAIRQAMAVKQGLVGFNAADIFL
PTLLSTFIGFCAGIAAVAWYQRINLFKPALLAYFGGFVAAMGLLFAWLRQFPPQQMAAWI
GLIGAGAILTIVVAFLVCGAFRRINVYETFVDGAKDGFQVAIGIVPYLVAVLVGIAVFRA
AGCMDVLMQGLSALFTHLGIDTRFVPALPVGLMKTLSGAGARGLMVDVMTTYGVDSFQGK
LAAIIQGSTETTFYVLAVYFGSVGIKDTRYALACGLWADLIGLVGAVLVAYLFFA