Protein Info for ABZR87_RS07355 in Ralstonia sp. UNC404CL21Col

Annotation: NADPH-dependent 7-cyano-7-deazaguanine reductase QueF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR03138: queuine synthase" amino acids 5 to 278 (274 residues), 417.7 bits, see alignment E=2.4e-129 PF14819: QueF_N" amino acids 16 to 127 (112 residues), 162 bits, see alignment E=5.9e-52 PF14489: QueF" amino acids 81 to 127 (47 residues), 30.7 bits, see alignment 3.1e-11 amino acids 191 to 265 (75 residues), 85.4 bits, see alignment E=2.6e-28

Best Hits

Swiss-Prot: 91% identical to QUEF_RALSO: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K06879, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 99% identity to rpf:Rpic12D_0339)

MetaCyc: 55% identical to 7-cyano-7-deazaguanine reductase (Escherichia coli K-12 substr. MG1655)
PreQ(1) synthase. [EC: 1.7.1.13]

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>ABZR87_RS07355 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF (Ralstonia sp. UNC404CL21Col)
MSNQPEHSPLGKTSAYKTEYDPSLLFPIPRQGKRDEIGLAAGTALPFFGVDLWNLYELSW
LNLRGKPQVALGTVIVPADSPNIVESKSFKLYLNSFNQTKVASHEALQQLIHHDLSEACG
APVQVRIVTHEEFARQRMGELDGLLLDRLDIETDVYQPTPELLHADEEESPVEETLVSHL
LKSNCLVTGQPDWGSVQIRYVGAPINQEALLKYLISFREHNEFHEQCVERIFTDILRQCR
PVKLAVYARYTRRGGLDINPFRTNYNTPWPDNLRNARQ