Protein Info for ABZR87_RS07290 in Ralstonia sp. UNC404CL21Col

Annotation: DUF6691 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 107 (2 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details PF20398: DUF6691" amino acids 1 to 136 (136 residues), 194.9 bits, see alignment E=4e-62

Best Hits

Swiss-Prot: 48% identical to Y1893_XYLFT: UPF0394 membrane protein PD_1893 (PD_1893) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K07112, (no description) (inferred from 97% identity to rpi:Rpic_0313)

Predicted SEED Role

"GENE II AND X PROTEINS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (137 amino acids)

>ABZR87_RS07290 DUF6691 family protein (Ralstonia sp. UNC404CL21Col)
MAIVIALVAGLLFGAGLIVSGMANPAKVLGFLDLFGQWDPSLAFVMAGAIAVGVVAFFVA
RRRGRSWLGTLIQLPSATGVTARLVLGSAVFGIGWGLAGFCPGPALVALGAGVPKAVGFV
AAMLAGMAVFSVLERKR