Protein Info for ABZR87_RS07285 in Ralstonia sp. UNC404CL21Col

Annotation: c-type cytochrome

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21342: SoxA-TsdA_cyt-c
  • amino acids 65 to 144 (80 residues), 48.2 bits, E=1.3e-16
• PF13442: Cytochrome_CBB3
  • amino acids 164 to 243 (80 residues), 35.2 bits, E=1.9e-12
• PF00034: Cytochrom_C
  • amino acids 166 to 243 (78 residues), 36.1 bits, E=2e-12

Best Hits

Swiss-Prot: 48% identical to TSDA_ALLVD: Thiosulfate dehydrogenase (tsdA) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: None (inferred from 97% identity to rpf:Rpic12D_0327)

MetaCyc: 48% identical to thiosulfate dehydrogenase (Allochromatium vinosum)
Thiosulfate dehydrogenase. [EC: 1.8.2.2]

Predicted SEED Role

"Cytochrome c family protein"

MetaCyc Pathways

• thiosulfate oxidation I (to tetrathionate) (1/1 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.2.2

Protein Sequence (269 amino acids)

>ABZR87_RS07285 c-type cytochrome (Ralstonia sp. UNC404CL21Col)
MTLCKLGAALALAIGTSAFAQTTPVTLPVPDEATIPAGPVGDAIKRGKLILTDTKRQLPH
NVGNGLNCTSCHLNGGTTPYASPWVGLTAAFPEYRSRSGAVISLQQRVNDCFQRSMNGKP
IAFDGEDMNAILAYMKWLSSGVPVGTNVTGRGFEKIDTALAPNRDNGKAVYAQRCAACHG
VEGQGLPNPQGGYLMPPLWGKDSFNVGAGMARMYTAAAFVKHNMPLGQGGTLTAQEAVDV
AAFFTQQPRPDYAARAKDWPKGDKPKDAR