Protein Info for ABZR87_RS07285 in Ralstonia sp. UNC404CL21Col

Annotation: c-type cytochrome

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF21342: SoxA-TsdA_cyt-c" amino acids 64 to 144 (81 residues), 48.5 bits, see alignment E=1.1e-16 PF13442: Cytochrome_CBB3" amino acids 164 to 243 (80 residues), 34.7 bits, see alignment E=2.8e-12 PF00034: Cytochrom_C" amino acids 166 to 243 (78 residues), 35.8 bits, see alignment E=2.6e-12

Best Hits

Swiss-Prot: 48% identical to TSDA_ALLVD: Thiosulfate dehydrogenase (tsdA) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: None (inferred from 97% identity to rpf:Rpic12D_0327)

MetaCyc: 48% identical to thiosulfate dehydrogenase (Allochromatium vinosum)
Thiosulfate dehydrogenase. [EC: 1.8.2.2]

Predicted SEED Role

"Cytochrome c family protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>ABZR87_RS07285 c-type cytochrome (Ralstonia sp. UNC404CL21Col)
MTLCKLGAALALAIGTSAFAQTTPVTLPVPDEATIPAGPVGDAIKRGKLILTDTKRQLPH
NVGNGLNCTSCHLNGGTTPYASPWVGLTAAFPEYRSRSGAVISLQQRVNDCFQRSMNGKP
IAFDGEDMNAILAYMKWLSSGVPVGTNVTGRGFEKIDTALAPNRDNGKAVYAQRCAACHG
VEGQGLPNPQGGYLMPPLWGKDSFNVGAGMARMYTAAAFVKHNMPLGQGGTLTAQEAVDV
AAFFTQQPRPDYAARAKDWPKGDKPKDAR