Protein Info for ABZR87_RS07200 in Ralstonia sp. UNC404CL21Col

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 679 PF13175: AAA_15" amino acids 1 to 85 (85 residues), 45.9 bits, see alignment E=2e-15 amino acids 226 to 362 (137 residues), 58.8 bits, see alignment E=2.3e-19 PF11398: DUF2813" amino acids 1 to 87 (87 residues), 28.7 bits, see alignment E=2.7e-10 PF13476: AAA_23" amino acids 5 to 113 (109 residues), 47 bits, see alignment E=1.5e-15 PF13304: AAA_21" amino acids 299 to 361 (63 residues), 45.2 bits, see alignment E=3.6e-15 PF20469: OLD-like_TOPRIM" amino acids 408 to 480 (73 residues), 57 bits, see alignment E=6.7e-19

Best Hits

KEGG orthology group: K07459, putative ATP-dependent endonuclease of the OLD family (inferred from 67% identity to rpc:RPC_3543)

Predicted SEED Role

"FIG131328: Predicted ATP-dependent endonuclease of the OLD family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (679 amino acids)

>ABZR87_RS07200 AAA family ATPase (Ralstonia sp. UNC404CL21Col)
MYISEIKIENFRLFGSGEHAFALSLKPGLTALIGENDAGKTALIDAIRLVLGTRDQEMLR
VDATDFHQSVAGAGRADQIIIRLQFRDLTAADRGAFAEFLTYETIDGKVETTLIITWVAK
RNNNESTSRRLLAPEWRTGANGDGPVLDFGARSLLTATYLRPLRDAERAMSAGRGSRLSQ
ILQHTKEIKGSGVGFDSAANPNPDPKTLSILGLGDYASYLFGESDGIKQASKRLNDEYLE
PLSFANDLLKASIGVNGSREDAIRLRQLLEKLELVLTGGKNEGSTHGRGLGSNNLLFMAC
ELLLLATESDGFPLLLIEEPEAHLHPQRQLRLMSFLQDQVDKIRQDGQKIQIIVSTHSPN
LASELRLDNLALIKGARAFPLCEGRTKLSKSDYRFLERFLDVTKANLFFARAVLVVEGDA
ESILLPVLAKLLGRDFHFYGVSVVNVGGVGLGRYARIFMREEPETDGLVNIPVACVTDMD
VMPNDAPWIVGKLKEGEAIPSRPPSKRQWRVKQDFPGDTLEQRREERRAKASGQRVETFV
ANEWTLEFDLAYFGLEKLVWGSAALALGDDGIQAGSLKQADVINAAETEFKLLVDQKLDK
ATLASHVYAKFEIEKASKAIAAQYLAESLEALMSEKKMTCDQLRDRLPPYVIAAIEYVTA
PFDANLAPGKSGDAGGALG