Protein Info for ABZR87_RS07090 in Ralstonia sp. UNC404CL21Col

Annotation: monovalent cation:proton antiporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 221 to 250 (30 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 296 to 320 (25 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details amino acids 533 to 552 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 9 to 376 (368 residues), 216.9 bits, see alignment E=6.2e-68 PF02254: TrkA_N" amino acids 413 to 526 (114 residues), 84.8 bits, see alignment E=8.5e-28 PF02080: TrkA_C" amino acids 587 to 656 (70 residues), 45.4 bits, see alignment E=9.3e-16

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 98% identity to rpi:Rpic_0269)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefB" in subsystem Glutathione-regulated potassium-efflux system and associated functions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (659 amino acids)

>ABZR87_RS07090 monovalent cation:proton antiporter family protein (Ralstonia sp. UNC404CL21Col)
MHSPLELTLVLLAAAVIGVVLFRMLQLPPMLAYLVVGVLIGPKATGLESDSAQTRYLAEF
GVVFLMFSIGLEFNLSKLRSMRRLVLGLGASQVVLTMLLTIPVSMLLSHWYPLSWQAGLA
LGGALAMSSTAIVSKMLAERLQLETEHGRNIISVLLFQDLAVVLLLIVIPSLGKNPTDLA
LALSVAALKITVALVLILFLGQKLLSRWFHLVAARRSQELFMLNLLLVTLGMAALTERLG
LSMALGAFLAGMLVSETPYKLQVEEDIKPFRDVLLGLFFVTVGMLLDPRVVFEHWALVLG
LVMAPVLFKFVLIALLARAFGSGGGAAIRTALGLAQAGEFGFVLLNQIDGMKLIDPLLGQ
AILAAMLLSMLLAPFLIQYSDVIAMRLSRTDWLMQSLAMTKIAAQSIATERHVIICGYGR
SGQNLAHMVEQEGIGYVALDLDPDRVREAAAAGEHVVYGDAARRESLVAAGIHRAAAVAI
TYADTASALKVLHHVQALEPTLPVIVRTIDDADLDRLQQAGATEVVPEIIEGSLMLASHA
LVLLGVPLRRVVRRAQEMRDARYSLLRGYFHGQDDEEDMLERDAVRLHSVPLAKGSPAIG
HKLGTMGLETFKTSVTAIRRQGIRALDPDPDTVLELGDIVVLRGTPEGLQMAEERLSPR