Protein Info for ABZR87_RS07080 in Ralstonia sp. UNC404CL21Col

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 46% identical to KDSC_SALTY: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (kdsC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03270, 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC: 3.1.3.45] (inferred from 95% identity to rpi:Rpic_0267)

MetaCyc: 47% identical to 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase monomer (Escherichia coli BL21(DE3))
3-deoxy-manno-octulosonate-8-phosphatase. [EC: 3.1.3.45]

Predicted SEED Role

"3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (EC 3.1.3.45)" in subsystem KDO2-Lipid A biosynthesis (EC 3.1.3.45)

MetaCyc Pathways

superpathway of (Kdo)₂-lipid A biosynthesis (14/17 steps found)
CMP-3-deoxy-D-manno-octulosonate biosynthesis (5/5 steps found)
CMP-8-amino-3,8-dideoxy-D-manno-octulosonate biosynthesis (4/7 steps found)
superpathway of Kdo₂-lipid A biosynthesis (14/25 steps found)

KEGG Metabolic Maps

Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>ABZR87_RS07080 HAD family hydrolase (Ralstonia sp. UNC404CL21Col)
MITPALFPADSVHSNIDARFPQAMERAARVRLMVFDVDGVLTDGRLLVGPEGEISKAFDT
LDGHGIKLLAQAGVTSAIITGRQSEIVAWRAGELGIEHLYQGVADKREAFAHLLAATQLQ
AADAGYMGDDWPDLPVMTMVGFAACPAQAHVELRGRAHYVAQATGGRGAVREVADLILKA
QGAYDALLAQLLHAPQPS